PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM06G22930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 411aa    MW: 45748.6 Da    PI: 9.4173
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM06G22930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.12.4e-11241181395
                      TT-EE--HHH.HTT.............---.....--SEEEEEETTS-EEEEEE..EEETTE...EEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3  13 sgrlvlpkkfaeeh.............ggkke...esktltledesgrsWevkliyrkksgr...yvltkGWkeFvkangLkegDfvvFkldgr 87 
                      ++rl++p +fa++              +   e   +   + +  + g++W+v+l+  +++ +    +l++GW+e + a+gL eg  vv++l++r
  OGLUM06G22930.1  24 LHRLSVPGEFAARLddddatgvgeeeeE---EsgrRAAAVLVVGPLGKVWRVELR--RSPAGdgeAWLGGGWSELAAAHGLGEGWGVVLRLERR 112
                      589********99999999998765442...1444677899999**********5..54444447*************************9987 PP

                      SEE..EEE CS
               B3  88 sefelvvk 95 
                        +   ++
  OGLUM06G22930.1 113 GVA--SLR 118
                      666..444 PP

2B343.65.5e-14146235397
                      EE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                      k l ++d      + +p kf+++h  +  +++++  ++  + g+ W+v+l  ++ +  ++l++GW  F  a++L eg +++F+++g++ f  +v
  OGLUM06G22930.1 146 KLLQQEDL---EKMKIPEKFVQQHltETYTNNHQNAIIVCPLGKFWRVEL--QREQPDVLLRDGWAPFLAAHDLSEGNILLFRYEGNMVF--TV 232
                      55533333...3478**********944445667899999**********..999999****************************9999..66 PP

                      EEE CS
               B3  95 kvf 97 
                       vf
  OGLUM06G22930.1 233 EVF 235
                      665 PP

3B3391.4e-12320400486
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
               B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                      +++++++  s +l++  +f++++g+ +++ +tl++  ++  sW+v ++ + +  +y+ + GW++F+ +n++kegD ++F  ++
  OGLUM06G22930.1 320 KEMTAYSIHS-LLSVRGTFCSQIGLLEACAITLKISMKKKGSWRVAFK-TANTYGYINGPGWRKFCLENEVKEGDRLTFNAIE 400
                      4446666655.69**********************************5.5555579***********************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.5E-1310123IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-1112125IPR015300DNA-binding pseudobarrel domain
CDDcd100171.16E-1112113No hitNo description
SMARTSM010195.2E-614123IPR003340B3 DNA binding domain
PfamPF023621.1E-825115IPR003340B3 DNA binding domain
PROSITE profilePS508639.50260123IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-20139240IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.04E-19140244IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.407141238IPR003340B3 DNA binding domain
CDDcd100173.00E-15142235No hitNo description
SMARTSM010191.0E-6144238IPR003340B3 DNA binding domain
PfamPF023626.1E-11152235IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-15315409IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.94E-13316409IPR015300DNA-binding pseudobarrel domain
CDDcd100171.79E-6317396No hitNo description
PfamPF023621.4E-9318400IPR003340B3 DNA binding domain
SMARTSM010190.031318409IPR003340B3 DNA binding domain
PROSITE profilePS508639.686349411IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MPLSAGSLRR RPKFAAPLLS PACLHRLSVP GEFAARLDDD DATGVGEEEE EESGRRAAAV  60
LVVGPLGKVW RVELRRSPAG DGEAWLGGGW SELAAAHGLG EGWGVVLRLE RRGVASLRVF  120
DPGFCLARFC TPHAGMRTKD RPRFIKLLQQ EDLEKMKIPE KFVQQHLTET YTNNHQNAII  180
VCPLGKFWRV ELQREQPDVL LRDGWAPFLA AHDLSEGNIL LFRYEGNMVF TVEVFLQNGC  240
LKEYKTAALY LTDGTEGPSN APQQSAAKVG VSPVKRKRTR RIEGTCLEGP NRKSRASPIS  300
VKVEPHKKHV SIVSQNSFTK EMTAYSIHSL LSVRGTFCSQ IGLLEACAIT LKISMKKKGS  360
WRVAFKTANT YGYINGPGWR KFCLENEVKE GDRLTFNAIE TTVWHVVIVH C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047920.0AP004792.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0505A04.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642658.10.0PREDICTED: putative B3 domain-containing protein Os06g0632500 isoform X1
SwissprotQ67VL70.0Y6325_ORYSJ; Putative B3 domain-containing protein Os06g0632500
TrEMBLA0A0E0AC580.0A0A0E0AC58_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g42630.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.19e-14B3 family protein